| Desktop | 80/100 | ✔ |
| Mobile | 48/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 45 KB | ✔ |
| Compression | 10 KB (-78.7%) | ✔ |
| Text/Html Ratio | 1031 / 45920 (bytes) = 2.25% | ❗ |
| Load Time | 0.78 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 12 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | Unknown | ✘ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 2 / 2 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| sale | 6 | ✘ | ✘ | ✘ |
| depot | 2 | ✘ | ✔ | ✘ |
| sweetleaf | 2 | ✘ | ✔ | ✘ |
| glue | 2 | ✘ | ✘ | ✘ |
| gorilla | 2 | ✘ | ✘ | ✘ |
| darkside | 2 | ✘ | ✘ | ✘ |
| fire | 2 | ✘ | ✘ | ✘ |
| white | 2 | ✘ | ✘ | ✘ |
| dialog | 2 | ✘ | ✘ | ✘ |
| more | 1 | ✘ | ✘ | ✘ |
| cadaedafnallamdangaoaarsaudawgaznbambbdbdtbgnbhdbifbmdbndbobbrlbsdbtnbwpbynbyrbzdcdfchfclfclpcnhcnycopcrccuccupcveczkdjfdkkdopdzdegpernetbeurfjdfkpgbpgelggpghsgipgmdgnfgtqgydhkdhnlhrkhtghufidrilsimpinriqdirriskjepjmdjodjpykeskgskhrkmfkpwkrwkwdkydkztlaklbplkrlrdlsllydmadmdlmgamkdmmkmntmopmromrumurmvrmwkmxnmyrmznnadngnnionoknprnzdomrpabpenpgkphppkrplnpygqarronrsdrubrwfsarsbdscrsdgseksgdshpsllsossrdsspstdstnsvcsypszlthbtjstmttndtoptryttdtwdtzsuahugxusduyuuzsvesvndvuvwstxafxcdxofxpfyerzarzmwzwl | 1 | ✘ | ✘ | ✘ |
| terms | 1 | ✘ | ✘ | ✘ |
| privacy | 1 | ✘ | ✘ | ✘ |
| website | 1 | ✘ | ✘ | ✘ |
| sitemap | 1 | ✘ | ✘ | ✘ |
|
With 0.78 seconds in page load, 45 KB of page size and all other reports below, the sweetleafdepot.com has a SEO score of 63 out of 100 |
| Title | Home |
| Description | SweetLeaf Depot |
| Keyword | Enter a list of comma-separated keywords here. For example: ottawa weed delivery, ottawa cannabis delivery, home weed delivery, home cannabis delivery, buy weed canada, buy cannabis canada, weed deals, cannabis deals |
| Age | 0 Years, 6 Days |
| Created | 6th-Sep-2022 |
| Updated | 6th-Sep-2022 |
| Expiry | 6th-Sep-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| sweetleafdepot.com | A | 3593 | ip:54.154.42.22 |
| sweetleafdepot.com | NS | 172793 | target:ns2.yoursrs.com |
| sweetleafdepot.com | NS | 172793 | target:ns1.yoursrs.com |
| sweetleafdepot.com | SOA | 604800 | mname:ns1.yoursrs.comrname:hostmaster.sweetleafdepot.comserial:2022090600refresh:1retry:1expire:86400minimum-ttl:604800 |
| sweetleafdepot.com | MX | 3600 | pri:10target:aspmx.l.google.com |
| sweetleafdepot.com | MX | 3600 | pri:30target:aspmx3.googlemail.com |
| sweetleafdepot.com | MX | 3600 | pri:30target:aspmx2.googlemail.com |
| sweetleafdepot.com | MX | 3600 | pri:30target:aspmx5.googlemail.com |
| sweetleafdepot.com | MX | 3600 | pri:20target:alt1.aspmx.l.google.com |
| sweetleafdepot.com | MX | 3600 | pri:20target:alt2.aspmx.l.google.com |
| sweetleafdepot.com | MX | 3600 | pri:30target:aspmx4.googlemail.com |
|
Domain Name: sweetleafdepot.com Registry Domain ID: 2723515047_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.yoursrs.com Registrar URL: http://www.realtimeregister.com Updated Date: Creation Date: 2022-09-06T15:39:23Z Registrar Registration Expiration Date: 2023-09-06T15:39:23Z Registrar: REALTIME REGISTER B.V. Registrar IANA ID: 839 Reseller: Freewebstore Ltd Domain Status: ok http://www.icann.org/epp#ok Registry Registrant ID: REDACTED FOR PRIVACY Registrant Name: REDACTED FOR PRIVACY Registrant Organization: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: NL Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: REDACTED FOR PRIVACY Registrant Fax: REDACTED FOR PRIVACY Registrant Fax Ext: REDACTED FOR PRIVACY Registrant Email: https://mydomainprovider.com/contact_domain/ Registry Admin ID: REDACTED FOR PRIVACY Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: REDACTED FOR PRIVACY Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: REDACTED FOR PRIVACY Admin Email: https://mydomainprovider.com/contact_domain/ Registry Tech ID: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: REDACTED FOR PRIVACY Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: REDACTED FOR PRIVACY Tech Email: https://mydomainprovider.com/contact_domain/ Name Server: ns1.yoursrs.com Name Server: ns2.yoursrs.com DNSSEC: not signed Registrar Abuse Contact Email: abuse[at]realtimeregister.com Registrar Abuse Contact Phone: +31.384530759 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2022-09-12T03:12:09Z |
| Server IP | 54.154.42.22 |
| Server Location | Ireland |
| Service Provider | AMAZON-02 |
| Domains (TLD) | Status |
|---|---|
| sweetleafdepot.net | Available |
| sweetleafdepot.org | Already Registered |
| sweetleafdepot.biz | Already Registered |
| sweetleafdepot.io | Already Registered |
| sweetleafdepot.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| swetleafdepot.com | Available |
| qweetleafdepot.com | Available |
| wweetleafdepot.com | Available |
| eweetleafdepot.com | Available |
| zweetleafdepot.com | Available |
| Propertiesinaspen.com |
| Bmcclub.com |
| Hylv.net |
| Jecenwer.com |
| Luisarae.com |
| Yogiwiththedots.com |
| Yh7.xyz |
| Sireneabiad.com |
| Chance-upstyle.com |
| Editphotosforfree.com |